PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13116_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 339aa    MW: 36736.6 Da    PI: 7.474
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13116_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-12104148347
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  cra_locus_13116_iso_5_len_1475_ver_3 104 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 148
                                           8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93997153IPR017930Myb domain
SuperFamilySSF466897.9E-1799154IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-19100152IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.9E-11101147IPR009057Homeodomain-like
SMARTSM007178.0E-11101151IPR001005SANT/Myb domain
PfamPF002491.1E-10104148IPR001005SANT/Myb domain
CDDcd001672.70E-9104149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLTHYSNS SGSGSATPQN  60
GHAAAHDSPG DTPDHPSAAA ADGYASEDFV AGSSSSRERK KGVPWTEEEH RMFLLGLQKL  120
GKGDWRGIAR NYVISRTPTQ VASHAQKYFI RQSNVSRRKR RSSLFDIIPD ESVEAPVVSR  180
DFFAVDPSQA ETQSNNPFPV PSAMDEEVES VESPKSNESE ALPPKPDDSS YSYPVVYPAY  240
VAPFFPVAFP MWSGYNVEPP KQETHEVVKP RAVHSKSPIN VDELVGMSKL SLAESNGDVQ  300
PPSLSLKLVE GSNRQSAFHA NPPSGSSGIN SSHSPIHAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081287.10.0PREDICTED: uncharacterized protein LOC105164353
TrEMBLA0A068UP160.0A0A068UP16_COFCA; Uncharacterized protein
STRINGSolyc08g078340.2.10.0(Solanum lycopersicum)